PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013627019.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 250aa    MW: 28523.8 Da    PI: 9.1228
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013627019.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.7e-161057148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll +++ ++G g W+ ++ + g++R++k+c++rw++yl
   XP_013627019.1 10 KGAWTAEEDSLLRRCIDKYGEGKWHQVPLRAGLNRCRKSCRLRWLNYL 57
                     79********************************************97 PP

2Myb_DNA-binding48.32.4e-1563108148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E +ll++++k+lG++ W++Ia +++ gRt++++k++w+++l
   XP_013627019.1  63 RGKLSSDEVDLLLRLHKLLGNR-WSLIAGRLP-GRTANDIKNYWNTHL 108
                      78999*****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-21560IPR009057Homeodomain-like
PROSITE profilePS5129418.464557IPR017930Myb domain
SuperFamilySSF466894.69E-288104IPR009057Homeodomain-like
SMARTSM007172.7E-14959IPR001005SANT/Myb domain
PfamPF002492.5E-151057IPR001005SANT/Myb domain
CDDcd001672.53E-101257No hitNo description
PROSITE profilePS5129424.82358112IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-2261111IPR009057Homeodomain-like
SMARTSM007171.9E-1462110IPR001005SANT/Myb domain
PfamPF002496.9E-1463108IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009745Biological Processsucrose mediated signaling
GO:0009753Biological Processresponse to jasmonic acid
GO:0019430Biological Processremoval of superoxide radicals
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0050832Biological Processdefense response to fungus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MEDSSKGLTK GAWTAEEDSL LRRCIDKYGE GKWHQVPLRA GLNRCRKSCR LRWLNYLKPT  60
IKRGKLSSDE VDLLLRLHKL LGNRWSLIAG RLPGRTANDI KNYWNTHLSK KHEPCCKTKM  120
KKRNVTFSST TPAQKIDVFK PRPRLFTVNN GCSHLHGLPE VDVVPPCLGL NNINNVCENS  180
MTYCNKAGEK YELFSNLMDG ENMWWESLLE ESKQPDGLVP KGTATKKGAT FAFDVEQLWN  240
MLDGETVELD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-2281112104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0136970.0KM013697.1 Raphanus sativus MYB transcription factor gene, complete cds; plastid.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013627019.10.0PREDICTED: transcription factor MYB114 isoform X1
RefseqXP_013708778.10.0PREDICTED: transcription factor MYB90-like isoform X1
SwissprotQ9FE251e-132MYB75_ARATH; Transcription factor MYB75
TrEMBLE5D8F30.0E5D8F3_BRAOB; MYB1
STRINGBra001917.1-P1e-175(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56650.11e-133production of anthocyanin pigment 1